DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eif4e2rs1

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_957053.1 Gene:eif4e2rs1 / 393732 ZFINID:ZDB-GENE-040426-1728 Length:228 Species:Danio rerio


Alignment Length:220 Identity:72/220 - (32%)
Similarity:119/220 - (54%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELMSGNEEELQPSLNRVMKNIDYDL----AMKHPLEHTWTLWHLEND-----RTKRWAEMLVDVT 94
            |.|..|.|..:.|:|....||...:    |.:|||::.:|.|:....     .|:.:.:.:..:.
Zfish    16 EEMKDNNESDRASINNNNNNIRRKMVTPAAGEHPLQYNYTFWYSRRTPSRPANTQSYEQNIRQMG 80

  Fly    95 SFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDK--ASRTYIDK 157
            :..:||.|:..|..:..|.||...:|:.:||:.|:|||||:.|||||:||:.|.|  |||     
Zfish    81 TVASVEQFWKFYSHLVRPGDLTGHSDFHLFKEGIKPMWEDEANKNGGKWIIRLRKGLASR----- 140

  Fly   158 MWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHL---GI 219
            .|.:::|.|:||.|...:||||||:::|.:.:.||:|.|.:.:......|...::.:|:|   .|
Zfish   141 FWENIILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKTANDQVTTSRIRDTLRRVLNLPPNTI 205

  Fly   220 MEIQYQVHKDAMVNHGPNVNAIYTL 244
            ||  |:.|.|::.::....|...||
Zfish   206 ME--YKTHNDSLKDNSSFRNTKITL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 54/162 (33%)
eif4e2rs1NP_957053.1 IF4E 52..208 CDD:279921 54/162 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.