DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eIF4E5

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster


Alignment Length:210 Identity:101/210 - (48%)
Similarity:148/210 - (70%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YDGLELMSGNEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTV 99
            ::|:.|.|.:.|.:...:        |.:..||||||.||||:|||||||.|.:||.::|..::|
  Fly    31 HEGVPLESNSPEPIDEEI--------YQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSV 87

  Fly   100 EDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLL 164
            |.|:|:|:.:|.|::|||..||.||||.|:|||||:.|..||||::.:.|:::..:|::|.|:||
  Fly    88 ETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILL 152

  Fly   165 CMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIMEIQYQVHKD 229
            .|:|:.|::||||||.|||:|||:||:|:||.:..|..|||.||:::|.||||....:|||:|.|
  Fly   153 LMVGQNFEYSDEICGAVINIRNKSNKISVWTANGSNEMAILEIGQKLKILLHLQSHSLQYQLHSD 217

  Fly   230 AMVNHGPNVNAIYTL 244
            ||......|.::|||
  Fly   218 AMSKFNSGVKSVYTL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 80/152 (53%)
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 80/152 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470293
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
1211.800

Return to query results.
Submit another query.