DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eIF4E4

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster


Alignment Length:219 Identity:97/219 - (44%)
Similarity:153/219 - (69%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGLELM----SGNEEELQPSLNRVMKNID--------YDLAMKHPLEHTWTLWHLENDRTKRWAE 88
            :|.|.:    |.:.|:|     :.:.::|        .||.:|||||:|||||:|||||:|.|.:
  Fly    14 NGTETLADSPSSSSEDL-----KTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRSKNWED 73

  Fly    89 MLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRT 153
            |..::|||:.||||:|:|..:|.||::::.:||.:|||.|:||||||.||.||||::.:.:.|:.
  Fly    74 MQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKA 138

  Fly   154 YIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLG 218
            .:||:|.|:||.:|||.|::::|:||.|||:|.|:||:|:||.:..|..|::.||.::::||.|.
  Fly   139 ELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVLP 203

  Fly   219 IMEIQYQVHKDAMVNHGPNVNAIY 242
            ..::|||:|||.|...|..:.|:|
  Fly   204 PHQLQYQLHKDTMCKQGSVIKAVY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 74/152 (49%)
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 74/152 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470284
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
1211.800

Return to query results.
Submit another query.