DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and Eif4e2

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001102278.1 Gene:Eif4e2 / 363275 RGDID:1307790 Length:174 Species:Rattus norvegicus


Alignment Length:160 Identity:60/160 - (37%)
Similarity:91/160 - (56%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGG 141
            |.:..|.|:..|:...|     ||.|:..|..:..|.||...:|:.:||:.|:||||||.|||||
  Rat    15 HRKMVRRKKQTEIRARV-----VEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGG 74

  Fly   142 RWILLLDK--ASRTYIDKMWHDLLLCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAI 204
            :||:.|.|  |||     .|.:|:|.|:||.|...:||||.|::||.:.:.:|:|.|.:.:....
  Rat    75 KWIIRLRKGLASR-----CWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATT 134

  Fly   205 LSIGRQIKELLHL---GIMEIQYQVHKDAM 231
            ..|...::.:|:|   .|||  |:.|.|::
  Rat   135 ARIRDTLRRVLNLPPNTIME--YKTHTDSI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 57/151 (38%)
Eif4e2NP_001102278.1 IF4E <32..155 CDD:279921 52/129 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.