DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and eIF4EHP

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:216 Identity:54/216 - (25%)
Similarity:93/216 - (43%) Gaps:63/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKR----WAEMLVDVTSFNTVEDFFSVYY 107
            |:.|..||              |:||:.|| .....|:|    :::.|..|....:|:.::|:|.
  Fly    40 EVGPGENR--------------LQHTYCLW-FSRKETQRAAADYSKSLHMVGRCASVQQWWSLYS 89

  Fly   108 FVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGECFQ 172
            .:..|:.||.:.:.::||:.|.|||||..|..||:|::.|.|   ..:|:.|.::.:.|:||.|.
  Fly    90 HLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRK---NKVDRAWENVCMAMLGEQFL 151

  Fly   173 HSDEICGVVINVR---------------------------NKANKLSLWTKDSRNVEAILSIGRQ 210
            ..|||||||:..:                           .|...:.:...:.|||...|:|   
  Fly   152 VGDEICGVVLQTKYPNPSIQVACSSRPIICIIYTRFVVQFGKCKIIIVTNNNKRNVYEFLTI--- 213

  Fly   211 IKELLHLGIMEIQYQVHKDAM 231
                       |..::|::.:
  Fly   214 -----------IVIKIHEEML 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 48/183 (26%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438282
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.