DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and EIF4E3

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001128123.1 Gene:EIF4E3 / 317649 HGNCID:31837 Length:224 Species:Homo sapiens


Alignment Length:205 Identity:60/205 - (29%)
Similarity:97/205 - (47%) Gaps:36/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GLELMSGNEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLW---HLENDRTKRWAEMLVDVTSFNT 98
            ||:.:|.    |||....|            ||..:||.|   .|........|..|..:.:..|
Human    33 GLQQLSA----LQPEPGGV------------PLHSSWTFWLDRSLPGATAAECASNLKKIYTVQT 81

  Fly    99 VEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLL 163
            |:.|:|||..:.|.:.|.:...|.:.:...||:||:::|..||.|.:.:.|.|.:.:   |.:||
Human    82 VQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTV---WKELL 143

  Fly   164 LCMIGE----CFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAIL----SIGRQIKELL-HLGI 219
            |..|||    |....||:.||.::||::.:.:.:|     ||.|.|    ::..:|.||| |:..
Human   144 LATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVW-----NVNASLVGEATVLEKIYELLPHITF 203

  Fly   220 MEIQYQVHKD 229
            ..:.|:.|::
Human   204 KAVFYKPHEE 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 49/164 (30%)
EIF4E3NP_001128123.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
IF4E 48..198 CDD:396291 48/157 (31%)