DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and Eif4e3

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001100082.1 Gene:Eif4e3 / 297481 RGDID:1586185 Length:207 Species:Rattus norvegicus


Alignment Length:174 Identity:53/174 - (30%)
Similarity:87/174 - (50%) Gaps:20/174 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PLEHTWTLW---HLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIR 129
            ||...||.|   .|........|..|..:.:..||:.|:|||..:.|.:.|.:...|.:.:...|
  Rat    31 PLHSPWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERR 95

  Fly   130 PMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGE----CFQHSDEICGVVINVRNKANK 190
            |:||:::|..||.|.:.:.|.|.:.:   |.:|||..|||    |....|||.||.::||::.:.
  Rat    96 PLWEEESNAKGGVWKMKVPKDSTSTV---WKELLLATIGEQFTDCAAADDEIIGVSVSVRDREDV 157

  Fly   191 LSLWTKDSRNVEAIL----SIGRQIKELL-HLGIMEIQYQVHKD 229
            :.:|     ||.|.|    ::..:|.:|| |:....:.|:.|::
  Rat   158 VQVW-----NVNASLVGEATVLEKIHQLLPHISFKAVFYKPHEE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 49/164 (30%)
Eif4e3NP_001100082.1 IF4E 34..181 CDD:279921 46/154 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.