DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and tif45

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_594228.1 Gene:tif45 / 2541706 PomBaseID:SPAC16E8.15 Length:218 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:67/189 - (35%)
Similarity:107/189 - (56%) Gaps:6/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EELQPSLNRVMKN-IDYDLAMKHPLEHTWTLWHLENDRT-KRWAEMLVDVTSFNTVEDFFSVYYF 108
            |..:.:|..|..: |:::|  ||||...||||.|..... ..|.|:..::.:||:||:|:.::..
pombe    18 EPQEKALRTVFDDKINFNL--KHPLARPWTLWFLMPPTPGLEWNELQKNIITFNSVEEFWGIHNN 80

  Fly   109 VKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGECFQH 173
            :.|.|.|.|.:||..|::.:||.|||..||.||:|...........:|:||...:|..|||....
pombe    81 INPASSLPIKSDYSFFREGVRPEWEDVHNKTGGKWAFQNKGRGGNALDEMWLTTVLAAIGETLDP 145

  Fly   174 S-DEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIME-IQYQVHKDA 230
            : .|:.|||||:|....:|::|||...|.|.::.||.:.|::|:|...| |::..|:|:
pombe   146 TGQEVMGVVINMRKGFYRLAVWTKSCNNREVLMEIGTRFKQVLNLPRSETIEFSAHEDS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 56/155 (36%)
tif45NP_594228.1 CDC33 1..218 CDD:227386 67/189 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
OMA 1 1.010 - - QHG54586
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9263
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.