DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and tif452

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_595451.1 Gene:tif452 / 2539870 PomBaseID:SPBC1709.18 Length:243 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:64/191 - (33%)
Similarity:105/191 - (54%) Gaps:6/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GNEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLE-NDRTKRWAEMLVDVTSFNTVEDFFSVY 106
            |....|...|:.|  |.:......|||:|.||||.|: ..:...|:::|.::.||.|||:|:.::
pombe    42 GRPARLLEGLSAV--NAETAFVKTHPLQHEWTLWFLKPPTQGLEWSDLLKEIISFKTVEEFWGIF 104

  Fly   107 YFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLLLCMIGECF 171
            ..:...|.|...:||..|.|.|||.|||..|.|||:| ....|...:.:|::|..::|..|||..
pombe   105 KTISKASMLPAKSDYSYFLKGIRPEWEDPQNMNGGKW-AYQSKHKGSNLDELWLYMVLAAIGETL 168

  Fly   172 QHS-DEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIME-IQYQVHKDA 230
            ..: .|:.|||.|:|....::::||::..:.:.:..||.:.||:|.:...| |:|..|:|:
pombe   169 DPTGKEVTGVVCNMRKGFYRIAVWTRNCNDKDVLEKIGLRFKEVLGISDKETIEYSAHEDS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 53/155 (34%)
tif452NP_595451.1 CDC33 16..243 CDD:227386 64/191 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
OMA 1 1.010 - - QHG54586
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9263
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.