DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and EIF4E1B

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001092878.1 Gene:EIF4E1B / 253314 HGNCID:33179 Length:242 Species:Homo sapiens


Alignment Length:166 Identity:74/166 - (44%)
Similarity:108/166 - (65%) Gaps:3/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPM 131
            |||::.|.||..:|||::.|.:.|..||..:|||||:::|..::..|.|....||.:||..|:||
Human    62 HPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPM 126

  Fly   132 WEDDTNKNGGRWILLLDKASR-TYIDKMWHDLLLCMIGECF-QHSDEICGVVINVRNKANKLSLW 194
            |||..||.||||::.|.|..| ..:|::|.:.|||:|||.| :||.|:||.|:|:|.|.:|:::|
Human   127 WEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVW 191

  Fly   195 TKDSRNVEAILSIGRQIKELLHLGIME-IQYQVHKD 229
            |:::.|...:|.:||..||.|.|.... |.||.|.|
Human   192 TREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHAD 227

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 67/155 (43%)
EIF4E1BNP_001092878.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
EIF4EBP1/2/3 binding. /evidence=ECO:0000250 62..65 2/2 (100%)
IF4E 63..222 CDD:366742 69/158 (44%)