DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and EIF4E

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001124151.1 Gene:EIF4E / 1977 HGNCID:3287 Length:248 Species:Homo sapiens


Alignment Length:227 Identity:85/227 - (37%)
Similarity:121/227 - (53%) Gaps:41/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFV 109
            |||...|...|.....|   :||||::.|.||..:||::|.|...|..::.|:|||||:::|..:
Human    18 EEEKTESNQEVANPEHY---IKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHI 79

  Fly   110 KPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKAS-RTYIDKMW----HDL------- 162
            :..|:|....||.:||..|.|||||:.||.||||::.|:|.. |:.:|:.|    .||       
Human    80 QLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETRWDLAMLPRLV 144

  Fly   163 --------------------LLCMIGECF-QHSDEICGVVINVRNKANKLSLWTKDSRNVEAILS 206
                                |||:|||.| .:||::||.|:|||.|.:|:::||.:..|.||:..
Human   145 SNFWPQVILPLQPPKVLELQLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTH 209

  Fly   207 IGRQIKELLHLGI---MEIQYQVHKDAMVNHG 235
            |||..||  .||:   :.|.||.|.|.....|
Human   210 IGRVYKE--RLGLPPKIVIGYQSHADTATKSG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 70/188 (37%)
EIF4ENP_001124151.1 IF4E 38..228 CDD:366742 72/191 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140839
Domainoid 1 1.000 187 1.000 Domainoid score I3336
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 214 1.000 Inparanoid score I3630
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8454
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.