DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and ife-4

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_508210.1 Gene:ife-4 / 180464 WormBaseID:WBGene00002062 Length:212 Species:Caenorhabditis elegans


Alignment Length:199 Identity:55/199 - (27%)
Similarity:101/199 - (50%) Gaps:17/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ELQPSLNRVMKNI-DYDLAMK--------HPLEHTWTLWHLENDRTK----RWAEMLVDVTSFNT 98
            |.:.|...|:|.: :..:.|:        |.|::::|..:......|    .:|..:..|....:
 Worm     2 EAETSTQEVVKQVKNLPILMEDAPVGSDDHQLQYSYTFSYFMRPTGKFDPEDYASYVQPVGIMKS 66

  Fly    99 VEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKASRTYIDKMWHDLL 163
            ||.|:|:....|.|:::....|...||..::|:|||..|..||:||:.|.|...|   ::|.:||
 Worm    67 VEQFWSIMVHFKRPTEMCDKADIHFFKTGVKPVWEDPANCKGGKWIIRLKKGLST---RIWENLL 128

  Fly   164 LCMIGECFQHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIMEI-QYQVH 227
            :.:|||.|...||:||.|.::||:.:.:|||.:::.:......|...::.:|.|....: :|:.|
 Worm   129 MAIIGEQFLVGDELCGAVCSIRNQEDIISLWNRNADDTPVTNRIRETLRSVLQLPQNTVLEYKRH 193

  Fly   228 KDAM 231
            .|.:
 Worm   194 DDCL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 45/157 (29%)
ife-4NP_508210.1 IF4E 35..190 CDD:279921 45/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.