DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and ife-1

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001255196.1 Gene:ife-1 / 176755 WormBaseID:WBGene00002059 Length:231 Species:Caenorhabditis elegans


Alignment Length:214 Identity:75/214 - (35%)
Similarity:120/214 - (56%) Gaps:18/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MSGNEEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSV 105
            :||.:|.        |...:...|..:||:..||.|:|.::|.|.|.:.|..|.:||||.:|:::
 Worm    13 ISGEKEG--------MTETEQTTAPIYPLKRNWTWWYLNDERNKSWEDRLKKVYTFNTVSEFWAL 69

  Fly   106 YYFVKPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKA-SRTYIDKMWHDLLLCMIGE 169
            |..::|||.|....||.||:.:|:||||...|.|||||::::||. :...:|.:|.::|:.::||
 Worm    70 YDAIRPPSGLNALCDYNVFRDDIQPMWEVPENSNGGRWLIVIDKGKTPEMVDAIWLEILMALVGE 134

  Fly   170 CF-QHSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGIME--------IQYQ 225
            .| :..:.|||:|.|||.|.:|:|:||||..:.|..:.||..:||.|.....:        |:|:
 Worm   135 QFGKDMESICGLVCNVRGKGSKISVWTKDCNDDETNMRIGVVLKEKLMAASKDHSKPLFDVIRYE 199

  Fly   226 VHKDAMVNHGPNVNAIYTL 244
            .|:.........|.|..:|
 Worm   200 DHESCQKKTSSVVKAKLSL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 63/162 (39%)
ife-1NP_001255196.1 IF4E 37..181 CDD:279921 61/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.