DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and ife-5

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001379255.1 Gene:ife-5 / 174871 WormBaseID:WBGene00002063 Length:201 Species:Caenorhabditis elegans


Alignment Length:176 Identity:63/176 - (35%)
Similarity:104/176 - (59%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPM 131
            :||:..|:.|.|.:||...|.:.|..|.:||||.:|::.|..:.|||.|....||.||:.:|:|.
 Worm     9 YPLQRNWSWWFLNDDRNASWQDRLKKVYTFNTVPEFWAFYEAILPPSGLNDLCDYNVFRDDIQPK 73

  Fly   132 WEDDTNKNGGRWILLLDKA-SRTYIDKMWHDLLLCMIGECF-QHSDEICGVVINVRNKANKLSLW 194
            ||...|.:||||:::::|. :...:|.:|.::||.:|||.| :..:.|||:|.|||.:.:|:|:|
 Worm    74 WEAPENWDGGRWLIIINKGKTPEVLDAVWLEILLALIGEQFGKDMESICGLVCNVRGQGSKISVW 138

  Fly   195 TKDSRNVEAILSIGRQIKELLHLGIME---------IQYQVHKDAM 231
            ||:..:.:..:.||..:||.|.....:         |.||.|::.:
 Worm   139 TKNCNDDDTNMRIGVVLKEKLMAAASKAHSKPLFDVIHYQTHRNCV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 58/163 (36%)
ife-5NP_001379255.1 IF4E 10..159 CDD:396291 58/148 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.