DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E3 and Eif4e

DIOPT Version :9

Sequence 1:NP_648194.1 Gene:eIF4E3 / 38923 FlyBaseID:FBgn0265089 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_446426.1 Gene:Eif4e / 117045 RGDID:69647 Length:217 Species:Rattus norvegicus


Alignment Length:196 Identity:82/196 - (41%)
Similarity:120/196 - (61%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EEELQPSLNRVMKNIDYDLAMKHPLEHTWTLWHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFV 109
            |||...|...|.....|   :||||::.|.||..:||::|.|...|..::.|:|||||:::|..:
  Rat    18 EEEKTESNQEVANPEHY---IKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHI 79

  Fly   110 KPPSDLKIFNDYMVFKKNIRPMWEDDTNKNGGRWILLLDKAS-RTYIDKMWHDLLLCMIGECF-Q 172
            :..|:|....||.:||..|.|||||:.||.||||::.|:|.. |:.:|:.|.:.|||:|||.| .
  Rat    80 QLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDD 144

  Fly   173 HSDEICGVVINVRNKANKLSLWTKDSRNVEAILSIGRQIKELLHLGI---MEIQYQVHKDAMVNH 234
            :||::||.|:|||.|.:|:::||.:..|.:|:..|||..||  .||:   :.|.||.|.|.....
  Rat   145 YSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKE--RLGLPPKIVIGYQSHADTATKS 207

  Fly   235 G 235
            |
  Rat   208 G 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E3NP_648194.1 IF4E 71..224 CDD:279921 67/157 (43%)
Eif4eNP_446426.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 4/8 (50%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000250|UniProtKB:P06730 37..40 2/2 (100%)
IF4E 38..197 CDD:396291 69/160 (43%)