DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13678 and CG13051

DIOPT Version :9

Sequence 1:NP_648193.1 Gene:CG13678 / 38922 FlyBaseID:FBgn0035859 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster


Alignment Length:108 Identity:55/108 - (50%)
Similarity:61/108 - (56%) Gaps:32/108 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKF-AAIFFAVVAVAAAKPGILAPLAAAPLAYTAPAVVGSAAYVA-PY-ASSYTAHSVAHSAAF 62
            |||| ||:.||:.|..||||||:     |||||:||.|  ::.||| || ||.|.          
  Fly     1 MFKFVAAVIFALFACVAAKPGIV-----APLAYSAPYV--ASPYVASPYVASPYV---------- 48

  Fly    63 PASYAAPVAAAYTAPIAAPLAAAYTAPYTRFATPYAAAYTSPL 105
                |||..|||||..|||...||||||        |||||||
  Fly    49 ----AAPYTAAYTAAYAAPYTTAYTAPY--------AAYTSPL 79



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.