Sequence 1: | NP_648193.1 | Gene: | CG13678 / 38922 | FlyBaseID: | FBgn0035859 | Length: | 128 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_730416.1 | Gene: | CG32212 / 317917 | FlyBaseID: | FBgn0052212 | Length: | 111 | Species: | Drosophila melanogaster |
Alignment Length: | 134 | Identity: | 47/134 - (35%) |
---|---|---|---|
Similarity: | 63/134 - (47%) | Gaps: | 31/134 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKFAAIFFAVVAVAAAKPGILAPLAAAPLAYTAPAVVGSAAYVAPYASSYTAHSVAHSAAFPAS 65
Fly 66 YAAPV--------AAAYTAPIAAPLAAAYTAPYTRFATPYAAAYTSPLAYSSPYVARPYVAAAAA 122
Fly 123 PLLL 126 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |