DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13674 and CG32214

DIOPT Version :9

Sequence 1:NP_001261570.1 Gene:CG13674 / 38921 FlyBaseID:FBgn0035858 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001262045.1 Gene:CG32214 / 317919 FlyBaseID:FBgn0052214 Length:116 Species:Drosophila melanogaster


Alignment Length:136 Identity:59/136 - (43%)
Similarity:72/136 - (52%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVCFFAVVAVAAAKPGIV-APLAYTAPAVVGSAAYVAPYASSYTANSVAHSAAFPA-AYTAAYTA 67
            ||...|:||.||||||:: ||||||||     .||.||          |...|.|| ..||..:.
  Fly     5 AVVVLALVACAAAKPGLLGAPLAYTAP-----LAYSAP----------AAVVAAPAPVVTATSSQ 54

  Fly    68 PVAAAYTAPVAAAYTAPVAAAYAAPAAYTAAYTAPIARYAATPFAAPIAAPVAAAYTAPI---AA 129
            .:|..|....||...|||||..|||.         :|:|||||.|||:|.....||:||:   ||
  Fly    55 VIARNYNGIAAAPVIAPVAAPLAAPV---------VAKYAATPLAAPLAYSSPLAYSAPLSYAAA 110

  Fly   130 AAPVLL 135
            :.|:|:
  Fly   111 SGPLLI 116



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.