| Sequence 1: | NP_001261570.1 | Gene: | CG13674 / 38921 | FlyBaseID: | FBgn0035858 | Length: | 137 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_730413.2 | Gene: | CG32213 / 317918 | FlyBaseID: | FBgn0052213 | Length: | 129 | Species: | Drosophila melanogaster |
| Alignment Length: | 138 | Identity: | 67/138 - (48%) |
|---|---|---|---|
| Similarity: | 77/138 - (55%) | Gaps: | 20/138 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 AVCFFAVVAVAAAKPGIV-APLAYTAP-AVVGSAAYVAPYASSYTANSVAHSAAFPAAYTAAYTA 67
Fly 68 PVAAAYTAPVAAAYTAPVAAAYAA-PAAYTAAYTAP-IARYAATPFAAPIAAPVAAAYTAPI--- 127
Fly 128 AAAAPVLL 135 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||