DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT86 and LamC

DIOPT Version :9

Sequence 1:XP_005268923.1 Gene:KRT86 / 3892 HGNCID:6463 Length:563 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:473 Identity:117/473 - (24%)
Similarity:202/473 - (42%) Gaps:112/473 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   146 GVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKL 210
            |...|:.|..|:                      :|:|||:::.||.|.|.:||::|.||.:|..
  Fly    31 GATSPTSPTRTS----------------------RQQEKEELQHLNDRLACYIDRMRNLENENSR 73

Human   211 LETKLQFYQ---NRECCQSNLEPLFEGYI--------ETLRREAECVEADSGRLASE-------- 256
            |..:|...|   |||  .|||:.::|..:        ||.:.:|: :|.|..||..|        
  Fly    74 LTQELNLAQDTVNRE--TSNLKAVYEKELAAARKLLDETAKEKAK-LEIDIKRLWEENDDLKPRL 135

Human   257 -----------------LNHVQEVLEGY------KKKYEEEVSLRATAENEFVA-----LKKDVD 293
                             .|...||...|      :||:|::.. ....|||.:.     |:|.::
  Fly   136 DKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAK-ELALENERLRRQLDDLRKQLE 199

Human   294 CAYLRKSDLEANVEALIQEIDFLRRLYEEEIRVLQS--HISDTSVVVKLDNSRDLNMDCIIAEIK 356
            ...|.:.|||...::|.:|:.|..:::.:|:...:|  .|..:.:..:|....:..:...:.|::
  Fly   200 AETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELR 264

Human   357 AQYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNS 421
            .||:..:..:|.|.|..|.::.:.:||...|..:......||:..:...|..|.|:::|.:..|:
  Fly   265 DQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNA 329

Human   422 KLEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRL 486
            .|.|.:.:.|...:.........:|.||..||:.:.:||..::|||.:|:.|:.||:|||.|.:|
  Fly   330 GLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKL 394

Human   487 LEGEEQRLCEGVGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSA 551
            |.|||:||                         :..:|...|..|.:.||.:.:  |.:|.:.|.
  Fly   395 LCGEERRL-------------------------NIESPGRPTTDSGISSNGSHL--TASASSRSG 432

Human   552 RV----------GVCGGS 559
            ||          |:.|.|
  Fly   433 RVTPSGRRSATPGISGSS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT86XP_005268923.1 Keratin_2_head <80..179 CDD:292825 4/32 (13%)
Filament 182..493 CDD:278467 97/359 (27%)
Prefoldin 302..417 CDD:298833 25/116 (22%)
RILP-like <392..>460 CDD:304877 15/67 (22%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 97/359 (27%)
ATP-synt_B <67..>142 CDD:304375 21/77 (27%)
MreC <178..>224 CDD:302802 12/46 (26%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.