DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13679 and CG14095

DIOPT Version :10

Sequence 1:NP_729345.1 Gene:CG13679 / 38919 FlyBaseID:FBgn0035856 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_649112.1 Gene:CG14095 / 40112 FlyBaseID:FBgn0036870 Length:162 Species:Drosophila melanogaster


Alignment Length:143 Identity:53/143 - (37%)
Similarity:68/143 - (47%) Gaps:32/143 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVCFFAVVAVAAAKPGLV-APLAAAP---LAYTAPAVVGSAAYV----------------APYAS 49
            ||...|::|..||||||: .||||.|   :|..||.|..:::.|                .|.|.
  Fly     5 AVVICALIACVAAKPGLLHTPLAALPAPVIAAPAPVVTAASSQVVARTFNGIAAAPVIAQVPVAP 69

  Fly    50 SYSAHSVAHSAAFP--AAYTAAYTAPVAAAYTAPVAAAYAAPI----APYAAAYTSPLA------ 102
            :....:||...|.|  |...|...||...|:.|||||..||||    ||:||...:|.|      
  Fly    70 APVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVAAPLAAPILNRVAPFAAPIATPFAAPYAHP 134

  Fly   103 YSSPYVATAAAPL 115
            |::|.:|..||||
  Fly   135 YAAPVLAKYAAPL 147

Return to query results.
Submit another query.