| Sequence 1: | NP_729345.1 | Gene: | CG13679 / 38919 | FlyBaseID: | FBgn0035856 | Length: | 119 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648193.1 | Gene: | CG13678 / 38922 | FlyBaseID: | FBgn0035859 | Length: | 128 | Species: | Drosophila melanogaster |
| Alignment Length: | 131 | Identity: | 101/131 - (77%) |
|---|---|---|---|
| Similarity: | 107/131 - (81%) | Gaps: | 18/131 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 KFIAVCFFAVVAVAAAKPGLVAPLAAAPLAYTAPAVVGSAAYVAPYASSYSAHSVAHSAAFPAAY 66
Fly 67 TAAYTAPVAAAYTAPV----AAAYAAP----IAPYAAAYTSPLAYSS-----PYVATAAAPLLLK 118
Fly 119 K 119 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45444802 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2CJIV | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0007619 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.840 | |||||