DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13679 and CG13674

DIOPT Version :9

Sequence 1:NP_729345.1 Gene:CG13679 / 38919 FlyBaseID:FBgn0035856 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001261570.1 Gene:CG13674 / 38921 FlyBaseID:FBgn0035858 Length:137 Species:Drosophila melanogaster


Alignment Length:142 Identity:97/142 - (68%)
Similarity:108/142 - (76%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAVCFFAVVAVAAAKPGLVAPLAAAPLAYTAPAVVGSAAYVAPYASSYSAHSVAHSAAFPAA 65
            |||:||||||||||||||||:|     ||||||||||||||||||||||||:|:|||||||||||
  Fly     1 MKFLAVCFFAVVAVAAAKPGIV-----APLAYTAPAVVGSAAYVAPYASSYTANSVAHSAAFPAA 60

  Fly    66 YTAAYTAPVAAAYTAPVAAAYAAPI-------APYAAAYTSPLA------YSSPYVA-------- 109
            |||||||||||||||||||||.||:       |.|.||||:|:|      :::|..|        
  Fly    61 YTAAYTAPVAAAYTAPVAAAYTAPVAAAYAAPAAYTAAYTAPIARYAATPFAAPIAAPVAAAYTA 125

  Fly   110 --TAAAPLLLKK 119
              .||||:||||
  Fly   126 PIAAAAPVLLKK 137



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJIV
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.