Sequence 1: | NP_729345.1 | Gene: | CG13679 / 38919 | FlyBaseID: | FBgn0035856 | Length: | 119 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261570.1 | Gene: | CG13674 / 38921 | FlyBaseID: | FBgn0035858 | Length: | 137 | Species: | Drosophila melanogaster |
Alignment Length: | 142 | Identity: | 97/142 - (68%) |
---|---|---|---|
Similarity: | 108/142 - (76%) | Gaps: | 28/142 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKFIAVCFFAVVAVAAAKPGLVAPLAAAPLAYTAPAVVGSAAYVAPYASSYSAHSVAHSAAFPAA 65
Fly 66 YTAAYTAPVAAAYTAPVAAAYAAPI-------APYAAAYTSPLA------YSSPYVA-------- 109
Fly 110 --TAAAPLLLKK 119 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444804 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2CJIV | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007619 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |