DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2M

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_003960.1 Gene:UBE2M / 9040 HGNCID:12491 Length:183 Species:Homo sapiens


Alignment Length:182 Identity:137/182 - (75%)
Similarity:154/182 - (84%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKLFTLKQQKKDGEQKG---SQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIIS 62
            |||||:||||||:.|..|   ...||||||||||||||||||||.||...|.||:|||||||:|.
Human     1 MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVIC 65

  Fly    63 PDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVY 127
            ||||||:.|:|||:|:||..|||:||||||.|.||||||||:||||||||||||.|||.||||:|
Human    66 PDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIY 130

  Fly   128 GLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECCL 179
            |||:||||||||||||||||:|||.|||.||.||:::||||.:|.||||.||
Human   131 GLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 105/134 (78%)
UBE2MNP_003960.1 Interaction with UBA3 1..57 38/55 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 16/27 (59%)
UQ_con 33..168 CDD:395127 105/134 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2378
eggNOG 1 0.900 - - E1_KOG0420
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2952
Inparanoid 1 1.050 291 1.000 Inparanoid score I2803
Isobase 1 0.950 - 0 Normalized mean entropy S621
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1302735at2759
OrthoFinder 1 1.000 - - FOG0003958
OrthoInspector 1 1.000 - - oto90058
orthoMCL 1 0.900 - - OOG6_102346
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4810
SonicParanoid 1 1.000 - - X2724
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.