DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2E2

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_689866.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens


Alignment Length:160 Identity:49/160 - (30%)
Similarity:86/160 - (53%) Gaps:4/160 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKQQKKDGEQKGSQQKKASAAQLRIQKDINELNL--PNTCATDFPDPNDLLNFK-LIISPDEGFY 68
            ::.:||:|:.......|.|.:..||||::.|:.|  |..|:.. |..:::..:: .|:.|....|
Human    36 VQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAG-PKGDNIYEWRSTILGPPGSVY 99

  Fly    69 RDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLF 133
            ..|.|..:.....:||.:||||...|::||.||:..|.:||:||:::|:|.|.|:.::..:..|.
Human   100 EGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLL 164

  Fly   134 LEPNPEDPLNKEAADVLQTNRRQFENNVKK 163
            .:.||.|||....|....|||.:.:...::
Human   165 TDCNPADPLVGSIATQYMTNRAEHDRMARQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 44/139 (32%)
UBE2E2NP_689866.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 4/18 (22%)
UBCc_UBE2E 58..198 CDD:467413 44/138 (32%)

Return to query results.
Submit another query.