DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2E1

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_003332.1 Gene:UBE2E1 / 7324 HGNCID:12477 Length:193 Species:Homo sapiens


Alignment Length:159 Identity:49/159 - (30%)
Similarity:83/159 - (52%) Gaps:6/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQQKKDGEQKGSQQKKASAAQLRIQKDINELNL--PNTCATDFPDPNDLLNFK-LIISPDEGFYR 69
            |::.|....|.|  |..|.:..||||::.::.|  |..|:.. |..:::..:: .|:.|....|.
Human    31 KKESKVSMSKNS--KLLSTSAKRIQKELADITLDPPPNCSAG-PKGDNIYEWRSTILGPPGSVYE 92

  Fly    70 DGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFL 134
            .|.|..:......||.:||||...|::||.||:..|.:||:||:::|:|.|.|:.::..:..|..
Human    93 GGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLT 157

  Fly   135 EPNPEDPLNKEAADVLQTNRRQFENNVKK 163
            :.||.|||....|....|||.:.:...::
Human   158 DCNPADPLVGSIATQYMTNRAEHDRMARQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 43/139 (31%)
UBE2E1NP_003332.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 5/15 (33%)
UBCc_UBE2E 50..190 CDD:467413 43/138 (31%)

Return to query results.
Submit another query.