DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2D3

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens


Alignment Length:136 Identity:45/136 - (33%)
Similarity:85/136 - (62%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IQKDINEL--NLPNTCATDFPDPNDLLNFK-LIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKC 92
            :.|::::|  :.|..|:.. |..:|:.::: .|:.|::..|:.|.|.......::||.:||||..
Human     8 LSKELSDLARDPPAQCSAG-PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAF 71

  Fly    93 ATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQF 157
            .|::|||||:.:|::||:|||..|:|.|.|:.::..:..|..:|||:|||..|.|.:.:|:|.::
Human    72 TTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKY 136

  Fly   158 ENNVKK 163
             |.:.:
Human   137 -NRISR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 45/134 (34%)
UBE2D3NP_871622.1 UBCc_UBE2D 6..147 CDD:467412 45/136 (33%)

Return to query results.
Submit another query.