DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and Ube2f

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_017177752.1 Gene:Ube2f / 67921 MGIID:1915171 Length:208 Species:Mus musculus


Alignment Length:169 Identity:66/169 - (39%)
Similarity:91/169 - (53%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KASAAQLRIQ----------------KDINEL--NLPNTCATDFPDPNDLLNFKLIISPDEGFYR 69
            ||||.|.|..                .::.||  |||.||...|||||.|..|:|.:|||||:|:
Mouse    36 KASATQCRCSAGHGFGCRLASPDSRCSEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQ 100

  Fly    70 DGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILRE------DWNPVLNINSIVYG 128
            .|:|.|...|...|...||||||.|:::||||...|.:||::|||      .|.|...:..:|:|
Mouse   101 GGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWG 165

  Fly   129 LQFLFLE-PNPEDPLNKEAADVLQTNRRQFENNVKKAMR 166
            |..||.: .|.:||||.|||:....::..|.:.|.:.::
Mouse   166 LNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 61/159 (38%)
Ube2fXP_017177752.1 UBCc 63..207 CDD:381827 60/142 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0420
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54493
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4810
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.