DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and Ube2d3

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_036019109.1 Gene:Ube2d3 / 66105 MGIID:1913355 Length:148 Species:Mus musculus


Alignment Length:131 Identity:46/131 - (35%)
Similarity:83/131 - (63%) Gaps:4/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIQKDINEL--NLPNTCATDFPDPNDLLNFK-LIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVK 91
            ||.|::::|  :.|..|:.. |..:|:.::: .|:.|::..|:.|.|.......::||.:||||.
Mouse     5 RINKELSDLARDPPAQCSAG-PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVA 68

  Fly    92 CATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQ 156
            ..|::|||||:.:|::||:|||..|:|.|.|:.::..:..|..:|||:|||..|.|.:.:|:|.:
Mouse    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDK 133

  Fly   157 F 157
            :
Mouse   134 Y 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 46/131 (35%)
Ube2d3XP_036019109.1 UBCc_UBE2D 3..145 CDD:467412 46/131 (35%)

Return to query results.
Submit another query.