DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and si:ch1073-205c8.3

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_001920670.3 Gene:si:ch1073-205c8.3 / 564377 ZFINID:ZDB-GENE-030131-1059 Length:185 Species:Danio rerio


Alignment Length:184 Identity:141/184 - (76%)
Similarity:157/184 - (85%) Gaps:5/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKLFTLKQQKKDGEQKGSQQ-----KKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLI 60
            |||||:|||||||.|..|..:     ||||||||||||||||||||.||...|||.:||||||||
Zfish     1 MIKLFSLKQQKKDEESAGGPRAGGGGKKASAAQLRIQKDINELNLPKTCEIVFPDQDDLLNFKLI 65

  Fly    61 ISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSI 125
            ||||||||:.|:|||:|:||..|||:||||||.|.||||||||:||||||||||||.|||.||||
Zfish    66 ISPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSI 130

  Fly   126 VYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECCL 179
            :||||:||||||||||||||||:|||||||.||.||::::|||.||.||||.||
Zfish   131 IYGLQYLFLEPNPEDPLNKEAAEVLQTNRRLFEQNVQRSLRGGYVGATYFERCL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 108/134 (81%)
si:ch1073-205c8.3XP_001920670.3 COG5078 28..173 CDD:227410 116/144 (81%)
UQ_con 35..168 CDD:278603 108/132 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I2258
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2952
Inparanoid 1 1.050 294 1.000 Inparanoid score I2751
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1302735at2759
OrthoFinder 1 1.000 - - FOG0003958
OrthoInspector 1 1.000 - - oto40045
orthoMCL 1 0.900 - - OOG6_102346
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2724
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.