DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2D4

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 / 51619 HGNCID:21647 Length:192 Species:Homo sapiens


Alignment Length:153 Identity:51/153 - (33%)
Similarity:85/153 - (55%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GEQKGSQQ-----KKASAAQLR---IQKDINELNLPNTCATDFPDPNDLLNFK-LIISPDEGFYR 69
            ||..||.|     |:..|..|.   :|:|     .|..|:.. |..:||.::: .|:.|::..|:
Human    33 GEASGSLQSWQKAKEKQACHLELTDLQRD-----PPAQCSAG-PVGDDLFHWQATIMGPNDSPYQ 91

  Fly    70 DGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFL 134
            .|.|.......::||.:||||...|::|||||:.:|::||:|||..|:|.|.::.::..:..|..
Human    92 GGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLC 156

  Fly   135 EPNPEDPLNKEAADVLQTNRRQF 157
            :|||:|||..|.|...:.:|.::
Human   157 DPNPDDPLVPEIAHTYKADREKY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 45/136 (33%)
UBE2D4XP_024302563.1 UBCc_UBE2D 54..190 CDD:467412 43/132 (33%)

Return to query results.
Submit another query.