DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and Ube2u

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001418144.1 Gene:Ube2u / 500511 RGDID:1565480 Length:337 Species:Rattus norvegicus


Alignment Length:153 Identity:42/153 - (27%)
Similarity:72/153 - (47%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAAQLRIQKDINEL-NLPNTCATDFPDPNDLLNFK-----LIISPDEGFYRDGRFVFNFRV--GS 81
            |.|...::::..|| |..:.....:|..:||:::|     |..|..||      .||:..:  ..
  Rat    13 SKAYSLLEREFKELQNSRSKGINAYPVSSDLMSWKAEIEGLKYSVCEG------LVFHLTIDFSQ 71

  Fly    82 NYPHEPPKVKCATQVYHPNI-DLDGNVCLNILRED--WNPVLNINSIVYGLQFLFLEPNPEDPLN 143
            :|...||.||..|..:|||: ...|...|.||.:.  |:....|..|::.||.|...|..::|||
  Rat    72 DYNLVPPVVKFVTIPFHPNVHPYTGQPSLGILDKPDMWDTSYTILRILFDLQMLLSYPMVKNPLN 136

  Fly   144 KEAADVLQTNRRQFENNVKKAMR 166
            .|||::|..:...:...:::.::
  Rat   137 LEAAELLVKDESLYRTVIRELLQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 41/147 (28%)
Ube2uNP_001418144.1 UBCc_UBE2U 18..156 CDD:467426 40/143 (28%)

Return to query results.
Submit another query.