DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and ube2f

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001011221.1 Gene:ube2f / 496657 XenbaseID:XB-GENE-960076 Length:185 Species:Xenopus tropicalis


Alignment Length:177 Identity:69/177 - (38%)
Similarity:99/177 - (55%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFTLKQQ-KKDGEQKGSQQKKASAAQLR--------IQKDINEL--NLPNTCATDFPDPNDLLNF 57
            :.||..: |:|...|||:....::...|        :.|::.||  |||.||..:|||||.|..|
 Frog     1 MLTLASKLKRDDGVKGSRTSSTTSDSTRRVSVRDRLLVKEVAELEANLPCTCKVNFPDPNKLHYF 65

  Fly    58 KLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILRE------DW 116
            .|.:||||.:|:.|||.|...|...|...||||||.|:::||||...|.:||::|||      .|
 Frog    66 HLTVSPDESYYQGGRFQFEIEVPDAYNMVPPKVKCLTRIWHPNITETGEICLSLLREHSIDGTGW 130

  Fly   117 NPVLNINSIVYGLQFLFLE-PNPEDPLNKEAADVLQTNRRQFENNVK 162
            .|...:..:|:||..||.: .|.:||||.|||:....::.::.|.|:
 Frog   131 APTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKDEYRNKVE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 62/150 (41%)
ube2fNP_001011221.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 7/27 (26%)
Interaction with uba3. /evidence=ECO:0000250 1..29 7/27 (26%)
COG5078 30..184 CDD:227410 61/148 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1302735at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4810
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.