DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG46338

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:122 Identity:29/122 - (23%)
Similarity:51/122 - (41%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EGFYRDGRFVFNFRVGSNYPHEP--PKVKCATQVYHPNI-----DLDGNVCLNILR--ED--WNP 118
            :|.|.:..|.|...:...:|.:.  |.:.....|.||::     .||.:......|  ||  |  
  Fly    60 QGLYAESVFRFTILLPDRFPDDKSLPSIIFQQDVIHPHVCPYTHSLDVSHAFPEWRCGEDHLW-- 122

  Fly   119 VLNINSIVYGLQFLFLEPNPE------DPL-NKEAADVLQTNRRQF----ENNVKKA 164
                 .::..||.:|.:|...      |.| |.|||::|..|:.::    :.|:|::
  Fly   123 -----QLLKYLQVIFSDPLDSIRGIEVDKLKNSEAAELLMNNKEEYVARVQENIKES 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 29/122 (24%)
CG46338NP_524888.1 UBCc 19..169 CDD:294101 27/115 (23%)
COG5078 24..176 CDD:227410 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.