DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and ube2m

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_988956.1 Gene:ube2m / 394553 XenbaseID:XB-GENE-1005525 Length:183 Species:Xenopus tropicalis


Alignment Length:182 Identity:136/182 - (74%)
Similarity:154/182 - (84%) Gaps:3/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKLFTLKQQKKDGEQKG---SQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIIS 62
            |||||:||||||:.|..|   ...||||||||||||||||||||.||..:|.|.:|||||||:|.
 Frog     1 MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCEIEFSDHDDLLNFKLVIC 65

  Fly    63 PDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVY 127
            ||||||:.|:|||:|:||..|||:||||||.|.||||||||:||||||||||||.|||.||||:|
 Frog    66 PDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIY 130

  Fly   128 GLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECCL 179
            |||:||||||||||||||||:|||.|||.||.||:::||||.:|.||||.||
 Frog   131 GLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 104/134 (78%)
ube2mNP_988956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 15/26 (58%)
UQ_con 33..168 CDD:365926 104/134 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 232 1.000 Domainoid score I2365
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2952
Inparanoid 1 1.050 289 1.000 Inparanoid score I2753
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1302735at2759
OrthoFinder 1 1.000 - - FOG0003958
OrthoInspector 1 1.000 - - otm48577
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4810
SonicParanoid 1 1.000 - - X2724
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.