DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG17030

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:63/136 - (46%) Gaps:11/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DGEQKGSQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNF 77
            ||.::   ..:..|..|..::::...||       ..:||::..:..::.|....|..|.:....
  Fly    10 DGPKR---MNRELALMLEDKQNLQFRNL-------LVEPNNIYKWTGLLMPVAPPYDKGAYKMEI 64

  Fly    78 RVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILR-EDWNPVLNINSIVYGLQFLFLEPNPEDP 141
            ....:||.:||::...|::||.|::..|.||:.||. |.|.|...|:.::..|.....:|.||:.
  Fly    65 DFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENA 129

  Fly   142 LNKEAA 147
            .:.|.|
  Fly   130 WHIEMA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 30/119 (25%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 32/134 (24%)
UQ_con 14..153 CDD:278603 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.