DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG16894

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:130 Identity:29/130 - (22%)
Similarity:53/130 - (40%) Gaps:33/130 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IISPDEGFYRDGRFVFNFRVGSNYPHE--PPKVKCATQVYHPNI-----DLDGNVCLNILRED-- 115
            :|....|.|....|.|:..:..|:|.:  .|.|..:|:|.||:|     .||....||..|:|  
  Fly    49 VIFVHSGIYAGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKTLDLAHFLNEWRKDEH 113

  Fly   116 --WNPVLNINSIVYGLQFLFLEPN---------------PEDPLNKEAADVLQTNRRQFENNVKK 163
              |:       ::..:|.:|.:|.               .::..|..|.::|..:|.::...|::
  Fly   114 HIWH-------VLRYIQAIFADPEGSICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEYIKRVQE 171

  Fly   164  163
              Fly   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 29/128 (23%)
CG16894NP_611455.1 UEV_AKTIP 18..130 CDD:467434 23/87 (26%)

Return to query results.
Submit another query.