DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and Ubc10

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:139 Identity:47/139 - (33%)
Similarity:73/139 - (52%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AQLRIQKDINEL--NLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPK 89
            |..|::|::::|  |...:......|.::||.:..:|.||...|..|.|.......:.||.:|||
  Fly     3 APRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPK 67

  Fly    90 VKCATQVYHPNIDLDGNVCLNIL-REDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTN 153
            :...|::||||||..|.|||.|: .|:|.|....:.:|..|..|..:|.||.||..|.|:....:
  Fly    68 INFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKD 132

  Fly   154 RRQFENNVK 162
            |::|..|.:
  Fly   133 RKKFVKNAE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 46/136 (34%)
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 46/136 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.