DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and Ube2f

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:XP_006245484.1 Gene:Ube2f / 363284 RGDID:1307608 Length:185 Species:Rattus norvegicus


Alignment Length:181 Identity:69/181 - (38%)
Similarity:102/181 - (56%) Gaps:18/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFTLKQQ-KKDGEQKGSQQKKASAAQLR--------IQKDINEL--NLPNTCATDFPDPNDLLNF 57
            :.||..: |:|...|||:...:::...|        :.|::.||  |||.||...|||||.|..|
  Rat     1 MLTLASKLKRDDGLKGSRASASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCF 65

  Fly    58 KLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILRE------DW 116
            :|.:|||||:|:.|:|.|...|...|...||||||.|:::||||...|.:||::|||      .|
  Rat    66 QLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGW 130

  Fly   117 NPVLNINSIVYGLQFLFLE-PNPEDPLNKEAADVLQTNRRQFENNVKKAMR 166
            .|...:..:|:||..||.: .|.:||||.|||:....::..|.:.|.:.::
  Rat   131 APTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 62/151 (41%)
Ube2fXP_006245484.1 UBCc 30..184 CDD:412187 61/152 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0420
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1302735at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.