powered by:
Protein Alignment UbcE2M and Kua
DIOPT Version :9
Sequence 1: | NP_001261567.1 |
Gene: | UbcE2M / 38916 |
FlyBaseID: | FBgn0035853 |
Length: | 181 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001188856.1 |
Gene: | Kua / 35300 |
FlyBaseID: | FBgn0032850 |
Length: | 310 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 26/68 - (38%) |
Gaps: | 20/68 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 ATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPE---DPLNKEAADVLQTNR 154
|:.:.|...|..|:|.: |::..| ||.|..| ||.:....|.::||.
Fly 130 ASGLVHWAADTWGSVDI--------PMIGKN---------FLRPFREHHLDPTSITRHDFIETNG 177
Fly 155 RQF 157
..|
Fly 178 DNF 180
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45438138 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.