DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG3473

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:146 Identity:48/146 - (32%)
Similarity:81/146 - (55%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIQKDINEL---NLPNTCATDFPDPNDLLNFKLIIS-PDEGFYRDGRFVFNFRVGSNYPHEPPKV 90
            ||.|:...|   .:|...||  ||..:...|.:::: |.:..:..|.|.....:..:||.:.|||
  Fly     7 RIIKETQRLLEDPVPGISAT--PDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKV 69

  Fly    91 KCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRR 155
            :..|:::|||||..|.:||:||::.|:|.|.|.:::..:|.|...|||:|||..:.|::.:.|.|
  Fly    70 RFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNER 134

  Fly   156 QF-----ENNVKKAMR 166
            :.     |..:|.||:
  Fly   135 RAIQLARECTLKHAMQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 45/141 (32%)
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 45/141 (32%)

Return to query results.
Submit another query.