DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG3473

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:146 Identity:48/146 - (32%)
Similarity:81/146 - (55%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIQKDINEL---NLPNTCATDFPDPNDLLNFKLIIS-PDEGFYRDGRFVFNFRVGSNYPHEPPKV 90
            ||.|:...|   .:|...||  ||..:...|.:::: |.:..:..|.|.....:..:||.:.|||
  Fly     7 RIIKETQRLLEDPVPGISAT--PDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKV 69

  Fly    91 KCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRR 155
            :..|:::|||||..|.:||:||::.|:|.|.|.:::..:|.|...|||:|||..:.|::.:.|.|
  Fly    70 RFLTKIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNER 134

  Fly   156 QF-----ENNVKKAMR 166
            :.     |..:|.||:
  Fly   135 RAIQLARECTLKHAMQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 46/143 (32%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 48/146 (33%)
COG5078 7..149 CDD:227410 46/143 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.