DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG4502

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:184 Identity:35/184 - (19%)
Similarity:73/184 - (39%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQQKKDGEQKGSQQKKASAA------QLRIQKDINE---LNLPNTCATDFPDPNDLL---NFKL- 59
            |::::|.:...:.:::..||      ..|:.|:..|   |...|.........||.|   :.:| 
  Fly   114 KRRRQDHKVAPTTERQLVAAPDHTIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLH 178

  Fly    60 IISPDEGFYRD------GRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDL-----DGNVCLNILR 113
            :|.||....||      ...:.:.....|:|..||.::    |..|:|:.     .|.:|:.:|.
  Fly   179 VIDPDSPLARDMAEMGVPAILLHLSFPDNFPFAPPFMR----VVEPHIEKGYVMEGGAICMELLT 239

  Fly   114 -EDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMR 166
             ..|.....:.:::  :||.......:..:.::.....:..|||.|.:.:..::
  Fly   240 PRGWASAYTVEAVI--MQFAASVVKGQGRIARKPKSTKEFTRRQAEESFRSLVK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 31/153 (20%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.