DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG40045

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:168 Identity:49/168 - (29%)
Similarity:82/168 - (48%) Gaps:23/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AQLRIQKDINELNLPNTC---ATDFPDPNDLLNFK-LIISPDEGFYRDGRFVFNFRVGSNYPHEP 87
            :.|.::|.:.||| .|..   :....|.||:..:: |||.|.:..|..|.|..:......||..|
  Fly     6 SSLLLKKQLAELN-KNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRP 69

  Fly    88 PKVKCATQVYHPNIDLDGNVCLNILRED-------------WNPVLNINSIVYGLQFLFLEPNPE 139
            |::|..|:::||||:.:|:||::||.|.             |.||..:.:|:..:..:..:||.|
  Fly    70 PRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDE 134

  Fly   140 DPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFEC 177
            .|.|.:||...:.:...|:..|.:     ||.::..||
  Fly   135 SPANVDAAKEWRESYTDFKRKVAR-----CVRKSQEEC 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 44/151 (29%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.