DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG5440

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:144 Identity:48/144 - (33%)
Similarity:76/144 - (52%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ASAAQLRIQKDINEL--NLPNTCATDFPDPNDLLNF-KLIISPDEGFYRDGRFVFNFRVGSNYPH 85
            :::|..||||:::|:  :.|..|:.. |..::|..: ..||.|.:..|.:|.|..:......||.
  Fly    19 SNSAVKRIQKELDEITRDPPQYCSAG-PKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVEYPF 82

  Fly    86 EPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVL 150
            .||.|...|.:||.||...|.:||:||:|.|:|.|.|:.|:..:..|..:.||:|||..:.....
  Fly    83 APPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDCNPKDPLMAKIGTEY 147

  Fly   151 QTNRRQFENNVKKA 164
            ..||.:.:   |||
  Fly   148 LKNRAEHD---KKA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 47/138 (34%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 48/144 (33%)
UQ_con 25..162 CDD:278603 47/138 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.