DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and CG2574

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:143 Identity:45/143 - (31%)
Similarity:78/143 - (54%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SQQKKASAAQLRIQKDINEL--NLPNTCATDFPDPNDLLNFKL-IISPDEGFYRDGRFVFNFRVG 80
            |.:...:...:||:.::.::  |.|..|..|. ...|||::.. :..|....|..|.|..:.|..
  Fly    55 STEAPLTGCVVRIKSELQDIRKNPPPNCTADL-HHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFP 118

  Fly    81 SNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKE 145
            ::||...|:::..|::||.|:|..|.:||::|.|.|:||:|:..::..:..|..|.||:|||...
  Fly   119 ASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMC 183

  Fly   146 AADVLQTNRRQFE 158
            .||..:||||:.:
  Fly   184 IADQYKTNRREHD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 44/132 (33%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 44/132 (33%)
UQ_con 66..203 CDD:278603 44/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.