DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UbcE2H

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:140 Identity:40/140 - (28%)
Similarity:66/140 - (47%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAAQLRIQKDINELNLPNTCATDFPDPNDL-LNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPP 88
            ||.:.|:..|:.:|.......|.....|:. :.|   ..|.|..|..|.:.....:..|||.:.|
  Fly     5 SAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKF---FGPTETPYEGGVWKVRVYLPDNYPFKSP 66

  Fly    89 KVKCATQVYHPNID-LDGNVCLNILREDWNPVLNINSIVYG-LQFLFLEPNPEDPLNKEAADVLQ 151
            .:....::|||||| ..|.|||:::.:.|..:.::::|... |..|...|||.||||::||.:..
  Fly    67 SIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYL 131

  Fly   152 TNRRQFENNV 161
            ....::...|
  Fly   132 HEPEEYHRKV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 38/135 (28%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.