DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2K

DIOPT Version :10

Sequence 1:NP_648187.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_005330.1 Gene:UBE2K / 3093 HGNCID:4914 Length:200 Species:Homo sapiens


Alignment Length:145 Identity:40/145 - (27%)
Similarity:69/145 - (47%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ASAAQLRIQKDINEL-----NLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNY 83
            |:.|..||:::..|:     ...|....|..|.|.......|..|.:..|..||:....::...|
Human     2 ANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETY 66

  Fly    84 PHEPPKVKCATQVYHPNI-DLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAA 147
            |..||||:..|:::|||| .:.|.:||:||::.|...:.:.:::..||.|.....|:||.:...|
Human    67 PFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVA 131

  Fly   148 DVLQTNRRQFENNVK 162
            :..:.|...|:...:
Human   132 NQYKQNPEMFKQTAR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_648187.1 UBCc_UBE2F_UBE2M 26..163 CDD:467414 39/143 (27%)
UBE2KNP_005330.1 UBCc_UBE2K 6..151 CDD:467420 38/141 (27%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.