DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UbcE2M and UBE2F

DIOPT Version :9

Sequence 1:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001265234.1 Gene:UBE2F / 140739 HGNCID:12480 Length:185 Species:Homo sapiens


Alignment Length:176 Identity:69/176 - (39%)
Similarity:98/176 - (55%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFTLKQQ-KKDGEQKGSQ--------QKKASAAQLRIQKDINEL--NLPNTCATDFPDPNDLLNF 57
            :.||..: |:|...|||:        .::.|.....:.|::.||  |||.||...|||||.|..|
Human     1 MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCF 65

  Fly    58 KLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILRE------DW 116
            :|.::||||:|:.|:|.|...|...|...||||||.|:::||||...|.:||::|||      .|
Human    66 QLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGW 130

  Fly   117 NPVLNINSIVYGLQFLFLE-PNPEDPLNKEAADVLQTNRRQFENNV 161
            .|...:..:|:||..||.: .|.:||||.|||:....::..|.|.|
Human   131 APTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 61/141 (43%)
UBE2FNP_001265234.1 Interaction with UBA3. /evidence=ECO:0000269|PubMed:19250909 1..29 7/27 (26%)
UBCc 30..184 CDD:412187 62/147 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0420
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54493
OrthoDB 1 1.010 - - D1302735at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.