DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7387 and Dnajc24

DIOPT Version :9

Sequence 1:	NP_648186.3	Gene:	CG7387 / 38915	FlyBaseID:	FBgn0035852	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_081268.1	Gene:	Dnajc24 / 99349	MGIID:	1919522	Length:	148	Species:	Mus musculus

Alignment Length:	124	Identity:	29/124 - (23%)
Similarity:	52/124 - (41%)	Gaps:	31/124 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHS-------EQKLKHFQELSNAYNILTD 153
            :.|| :|.:||.:..|.:..::..:..|...||||...:       |:.::.|.|:..|:.||.:
Mouse     7 LKKD-WYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGN 70

  Fly   154 ETKRLEYD---------QLGGIK-------------DERAFLE-QAGNPLNVGLEEAKK 189
            |..:.:||         .:|.:.             ||..||. :.|....|..:||::
Mouse    71 EETKKKYDLQRHEDELRNVGPVDAQVRLEEMSWNQGDESFFLSCRCGGKYTVSKDEAQE 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7387	NP_648186.3	DnaJ_bact	101..431	CDD:274090	27/119 (23%)
		DnaJ	101..161	CDD:278647	16/66 (24%)
		DnaJ_zf	233..296	CDD:199908
		DnaJ_C	298..416	CDD:199909
Dnajc24	NP_081268.1	DnaJ	10..78	CDD:306689	17/68 (25%)
Dnajc24	NP_081268.1	zf-CSL	94..147	CDD:310075	8/36 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0715
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810