DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and cbpA

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_415520.1 Gene:cbpA / 947572 ECOCYCID:EG12193 Length:306 Species:Escherichia coli


Alignment Length:358 Identity:82/358 - (22%)
Similarity:144/358 - (40%) Gaps:78/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQ 162
            || ||.::||.....::.|::|:..||::||||.:........|:|::.|:.:|:||.:|.||||
E. coli     4 KD-YYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQ 67

  Fly   163 LGGIKDE----RAFLEQAGNPLNVGLEEAKKFDS------DKTTNDEINKLKSNEFDLPLD---F 214
            :...:::    |.|....|...|     |:.||.      .:.......:..:...|:.::   |
E. coli    68 MWQHRNDPQFNRQFHHGDGQSFN-----AEDFDDIFSSIFGQHARQSRQRPATRGHDIEIEVAVF 127

  Fly   215 LEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCK 279
            ||.|:...|| .:.|........|    |..:::.|          .:..|.|.........:.|
E. coli   128 LEETLTEHKR-TISYNLPVYNAFG----MIEQEIPK----------TLNVKIPAGVGNGQRIRLK 177

  Fly   280 GKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQVTYRLSVPSSDYFRRV 344
            |:.....|                       |..:||:..:|:            :.....|..|
E. coli   178 GQGTPGEN-----------------------GGPNGDLWLVIH------------IAPHPLFDIV 207

  Fly   345 GNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVRSREGVGNHIVTLK 409
            |.|:.....::..||.||....:..|.||:.|.:.||:|:..::.:.|||:.|::..|:....||
E. coli   208 GQDLEIVVPVSPWEAALGAKVTVPTLKESILLTIPPGSQAGQRLRVKGKGLVSKKQTGDLYAVLK 272

  Fly   410 VRIP----RNLSVKQRQLVLALSQAEDPVFEPK 438
            :.:|    .|.:...:||..|.|.     |:|:
E. coli   273 IVMPPKPDENTAALWQQLADAQSS-----FDPR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 78/346 (23%)
DnaJ 101..161 CDD:278647 20/59 (34%)
DnaJ_zf 233..296 CDD:199908 8/62 (13%)
DnaJ_C 298..416 CDD:199909 27/121 (22%)
cbpANP_415520.1 PRK10266 1..306 CDD:182347 82/358 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.